Cagrilintide

Cagrilintide — a metabolic research material, supplied as a vial with third-party analytical testing and per-batch documentation.

About Cagrilintide

Cagrilintide (development code AM833) is a synthetic, long-acting amylin analog built on a 37-amino-acid pramlintide-like backbone with key substitutions and N-terminal fatty-diacid acylation via a gamma-glutamic acid linker. It contains an intramolecular disulfide bridge (Cys2-Cys7) and a C-terminal amide. In experimental systems it acts as a non-selective agonist of the amylin receptor family (AMY1-3) and the calcitonin receptor, with reported subpicomolar to picomolar binding affinities.

In preclinical and in-vitro research, cagrilintide has been studied for its prolonged receptor engagement relative to native amylin, and as a combination partner with GLP-1 receptor agonists in models of energy balance and food intake. Its acylation-based design confers extended circulating half-life, making it a reference amylin-class research peptide. This material is supplied strictly for Research Use Only.

Specifications

Identification

• Material: Cagrilintide
• Also searched as: AM833
• Research Area: Metabolic Research
• Presentation: Vial
• Available Sizes: 5mg · 10mg
• CAS Number: 1415456-99-3
• Molecular Formula: C194H312N54O59S2
• Molecular Weight: 4409.1 g/mol
• Type: Synthetic acylated cyclic peptide (amylin analog)
• Receptor / Target: Amylin receptors (AMY) and calcitonin receptor (CTR)
• PubChem CID: 164618153

Amino Acid Sequence

(Eicosanedioic acid-γ-Glu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Cys2-Cys7 disulfide)

Analytical Data

• Purity (HPLC): ≥99%
• Identity (MS): Confirmed to specification
• Testing: Accredited (ISO 17025) third-party laboratory
• Documentation: Per-batch COA

Key Characteristics

• Molecular Formula: C194H312N54O59S2
• Molecular Weight: 4409.1 g/mol
• CAS Number: 1415456-99-3
• PubChem CID: 164618153
• Receptor / Target: Amylin receptors (AMY1-3) and calcitonin receptor (CTR)
• Molecular Type: Synthetic 37-residue acylated cyclic peptide
• Form: Lyophilized powder in vial
• Storage: Store lyophilized at -20 C to -80 C; protect from light
• Stability: Lyophilized stable for extended periods frozen

Research Context

• Amylin receptor pharmacology — Reference agonist for AMY1-3 and calcitonin receptor binding and signaling studies.
• Energy balance and satiety research — Model peptide used in preclinical study of food intake and body-weight regulation.
• GLP-1 co-agonism studies — Frequently paired with GLP-1R agonists in combination metabolic-research models.
• Long-acting peptide design — Illustrates fatty-diacid acylation strategy for extended half-life amylin analogs.

Research Findings

Preclinical and early clinical-pharmacology research characterizes cagrilintide as a long-acting amylin analog with potent activity at amylin and calcitonin receptors and a markedly extended duration of action compared with native amylin. Studies have examined its effects on food intake and body weight in animal models and its combination with GLP-1 receptor agonists.

These observations derive from experimental and preclinical settings and are provided for scientific context only. No human efficacy or therapeutic conclusions are implied by this listing.

History

Cagrilintide (AM833) was developed by Novo Nordisk as a long-acting amylin analog, extending the amylin-pharmacology field established by the earlier analog pramlintide. Its discovery and early pharmacology were reported by Kruse and colleagues, and it has since been studied both alone and in fixed combination with the GLP-1 agonist a long-acting GLP-1 receptor agonist (a cagrilintide + GLP-1 agonist combination).

References

1. Kruse T, et al. (2021). Development of Cagrilintide, a Long-Acting Amylin Analogue. Journal of Medicinal Chemistry.

View compound profile on NIH PubChem

Cited literature refers to laboratory and preclinical research. Cagrilintide is supplied strictly for research use only and is not intended to diagnose, treat, cure, or prevent any disease.

Why researchers choose Helio

• 99%+ Purity — HPLC-verified every batch
• Accredited Testing — Independent ISO 17025 laboratory
• Per-Batch COA — Documentation tied to your lot
• Made in the USA — Discreet, protected shipping

Frequently Asked

Are these research materials third-party tested?

Yes — every batch is analysed by an accredited (ISO 17025) independent laboratory using HPLC and mass spectrometry, with a per-batch Certificate of Analysis.

What purity are the materials?

Materials are verified to 99%+ HPLC purity. Any batch that does not meet the threshold is not released.

Do you provide a Certificate of Analysis (COA)?

Yes. Per-batch COA documentation is provided and is traceable by lot number.

Where do you ship from?

Materials are shipped from the USA in discreet, protective packaging.

Are these products for human use?

No. All materials are sold strictly for laboratory research use only — not for human or animal consumption, diagnosis, treatment, or prevention of any disease.

Research use only — not for human or animal consumption. Per-batch documentation is provided with the material.