Cagrilintide + GLP-1 Blend

Cagrilintide + GLP-1 Blend — a metabolic research material, supplied as a vial with third-party analytical testing and per-batch documentation.

About Cagrilintide + GLP-1 Blend

This research blend combines two distinct metabolic peptides in a single vial: cagrilintide, a synthetic long-acting amylin analog that agonizes amylin (AMY1-3) and calcitonin receptors, and GLP-1, the native incretin peptide that agonizes the glucagon-like peptide-1 receptor (GLP-1R). Because it is a physical mixture of two molecules, the blend has no single molecular formula, weight, or CAS number; each component retains its own identity, and the relevant specifications are listed per component below.

In preclinical research, the pairing of an amylin analog with a GLP-1 receptor agonist has been of interest for studying complementary signaling across the amylin and incretin axes in models of energy balance, food intake, and glucose handling. This co-formulation mirrors the scientific rationale behind combination amylin/GLP-1 research programs. This material is supplied strictly for Research Use Only and is not for human or animal use.

Specifications

Identification

• Material: Cagrilintide + GLP-1 Blend
• Also searched as: AM833
• Research Area: Metabolic Research
• Presentation: Vial
• Available Sizes: 2.5mg/2.5mg (5mg) · 5mg/5mg (10mg)
• Type: Two-component peptide blend (amylin analog + incretin)
• Receptor / Target: Amylin / calcitonin receptors (cagrilintide) and GLP-1R (GLP-1)

Analytical Data

• Purity (HPLC): ≥99%
• Identity (MS): Confirmed to specification
• Testing: Accredited (ISO 17025) third-party laboratory
• Documentation: Per-batch COA

Component Profiles

Cagrilintide

• Formula C194H312N54O59S2
• Weight 4409.1 g/mol
• CAS 1415456-99-3
• Structure Synthetic 37-residue acylated cyclic peptide; (Eicosanedioic acid-γ-Glu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 with Cys2-Cys7 disulfide
• Receptor Amylin receptors (AMY1-3) and calcitonin receptor (CTR)

GLP-1 (7-37)

• Formula C151H228N40O47
• Weight 3355.71 g/mol
• CAS 106612-94-6
• Structure Native linear 30-residue incretin peptide; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
• Receptor Glucagon-like peptide-1 receptor (GLP-1R)

Key Characteristics

• Molecular Type: Two-component peptide blend
• Receptor / Target: Amylin/calcitonin receptors and GLP-1R
• Form: Co-lyophilized powder in vial
• Storage: Store lyophilized at -20 C to -80 C; protect from light
• Stability: Lyophilized stable for extended periods frozen

Research Context

• Amylin / incretin co-signaling — Model system for complementary activation of amylin and GLP-1 receptor axes.
• Energy balance research — Used in preclinical study of food intake and body-weight regulation.
• Glucose homeostasis — Combined agonism studied in cell-based and animal glucose-handling models.
• Combination formulation studies — Reflects the research rationale of amylin/GLP-1 combination approaches.

Research Findings

Preclinical research on combined amylin-analog and GLP-1 receptor agonist research has explored whether the two mechanisms produce complementary effects on satiety, food intake, and metabolic parameters relative to either agent alone. Findings are specific to the experimental models used and to the individual pharmacology of each component.

These observations derive from experimental and preclinical settings and are provided for scientific context only. No human efficacy or therapeutic conclusions are implied by this listing.

History

The scientific rationale for pairing an amylin analog with a GLP-1 agonist grew out of parallel development of long-acting amylin analogs such as cagrilintide and the established GLP-1 incretin field, exemplified by combination programs studying amylin plus GLP-1 receptor agonism for metabolic research.

References

1. Kruse T, et al. (2021). Development of Cagrilintide, a Long-Acting Amylin Analogue. Journal of Medicinal Chemistry.
2. Mojsov S, Weir GC, Habener JF (1987). Insulinotropin: glucagon-like peptide I (7-37) co-encoded in the glucagon gene is a potent stimulator of insulin release in the perfused rat pancreas. Journal of Clinical Investigation.

Cited literature refers to laboratory and preclinical research. Cagrilintide + GLP-1 Blend is supplied strictly for research use only and is not intended to diagnose, treat, cure, or prevent any disease.

Why researchers choose Helio

• 99%+ Purity — HPLC-verified every batch
• Accredited Testing — Independent ISO 17025 laboratory
• Per-Batch COA — Documentation tied to your lot
• Made in the USA — Discreet, protected shipping

Frequently Asked

Are these research materials third-party tested?

Yes — every batch is analysed by an accredited (ISO 17025) independent laboratory using HPLC and mass spectrometry, with a per-batch Certificate of Analysis.

What purity are the materials?

Materials are verified to 99%+ HPLC purity. Any batch that does not meet the threshold is not released.

Do you provide a Certificate of Analysis (COA)?

Yes. Per-batch COA documentation is provided and is traceable by lot number.

Where do you ship from?

Materials are shipped from the USA in discreet, protective packaging.

Are these products for human use?

No. All materials are sold strictly for laboratory research use only — not for human or animal consumption, diagnosis, treatment, or prevention of any disease.

Research use only — not for human or animal consumption. Per-batch documentation is provided with the material.