GLP-1 Dissolvable Strips
About GLP-1 Dissolvable Strips
GLP-1 (7-37) is the fully processed, biologically active form of glucagon-like peptide-1, a 30-amino-acid incretin hormone derived from the proglucagon gene and secreted by intestinal L-cells. In experimental systems it is characterized as an endogenous agonist of the glucagon-like peptide-1 receptor (GLP-1R), a class B G-protein-coupled receptor. Because "GLP-1" is a generic class designation rather than a single proprietary molecule, laboratory reference material most commonly corresponds to the native GLP-1 (7-37) or GLP-1 (7-36) amide sequence.
In preclinical and in-vitro research, GLP-1 (7-37) has been widely used as a model incretin ligand to probe receptor pharmacology, cyclic-AMP signaling, and glucose-dependent insulinotropic pathways in pancreatic islet and cell-line systems. Native GLP-1 is rapidly cleaved by dipeptidyl peptidase-4 (DPP-4), a property that has made it a foundational reference compound in studies of peptide stability and in the design of longer-acting GLP-1R agonists. This material is supplied strictly for Research Use Only.
Format: supplied as dissolvable oral strips (10 per box) — a fast, needle-free research format. Exact per-strip potency is printed on the packaging.
Research use only — not for human or animal consumption. Per-batch documentation is provided with the material.
GLP-1 is an incretin peptide central to metabolic, appetite, and glucose-regulation research.
Supplied as dissolvable oral strips — 10 strips per box — for fast, consistent, needle-free handling in the research setting. Exact per-strip potency is printed on the packaging.
Every batch is independently tested by an ISO 17025-accredited laboratory to ≥99% purity, with a certificate of analysis on file for its exact lot.
For research use only. Not for human or veterinary consumption, diagnosis, or treatment.
Specifications
- MaterialGLP-1 Dissolvable Strips
- Also searched asGLP1, GLP 1
- Research AreaMetabolic Research
- PresentationDissolvable Strips
- CAS Number106612-94-6
- Molecular FormulaC151H228N40O47
- Molecular Weight3355.71 g/mol
- TypeLinear peptide (incretin hormone)
- Receptor / TargetGlucagon-like peptide-1 receptor (GLP-1R)
- PubChem CID44290899 →
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
- Purity (HPLC)≥99%
- Identity (MS)Confirmed to specification
- TestingAccredited (ISO 17025) third-party laboratory
- DocumentationPer-batch COA →
In vitro and preclinical studies describe GLP-1 (7-37) as a high-affinity agonist of the GLP-1 receptor that stimulates adenylate-cyclase and cAMP accumulation, effects that have been used to characterize glucose-dependent insulinotropic activity in pancreatic islet and transfected cell-line models. Investigations have also documented the rapid inactivation of native GLP-1 by DPP-4 through cleavage of the N-terminal His-Ala dipeptide.
These observations are drawn from experimental and in-vitro settings and are provided for scientific context only. No human efficacy, dosing, or therapeutic conclusions are implied.
Glucagon-like peptide-1 was identified in the 1980s following the cloning of the proglucagon gene, and the truncated GLP-1 (7-37) and GLP-1 (7-36) amide forms were subsequently established as the active incretin species by Orskov, Holst, and colleagues. This work laid the biochemical foundation for the incretin field and the later development of GLP-1 receptor agonists and DPP-4 inhibitors.
- Orskov C, Holst JJ, et al. (1989). Complete sequences of glucagon-like peptide-1 from human and pig small intestine. Journal of Biological Chemistry.
- Mojsov S, Weir GC, Habener JF (1987). Insulinotropin: glucagon-like peptide I (7-37) co-encoded in the glucagon gene is a potent stimulator of insulin release in the perfused rat pancreas. Journal of Clinical Investigation.
- Holst JJ (2007). The physiology of glucagon-like peptide 1. Physiological Reviews.
View compound profile on NIH PubChem →
Cited literature refers to laboratory and preclinical research. This material is supplied strictly for research use only and is not intended to diagnose, treat, cure, or prevent any disease.
Are these research materials third-party tested?
Yes — every batch is analysed by an accredited (ISO 17025) independent laboratory using HPLC and mass spectrometry, with a per-batch Certificate of Analysis.
What purity are the materials?
Materials are verified to 99%+ HPLC purity. Any batch that does not meet the threshold is not released.
Do you provide a Certificate of Analysis (COA)?
Yes. Per-batch COA documentation is provided and is traceable by lot number.
Where do you ship from?
Materials are shipped from the USA in discreet, protective packaging.
Are these products for human use?
No. All materials are sold strictly for laboratory research use only — not for human or animal consumption, diagnosis, treatment, or prevention of any disease.
More Metabolic Research materials
✓ ≥99% View COA ›
MOTS-c 10MG Research Vial - Mitochondrial-Derived Peptide | Third-Party Tested
✓ ≥99% View COA ›
GLP-3 (Retatrutide) 15MG Research Vial - GLP-1/GIP/Glucagon Triple Receptor Agonist | Third-Party Tested
RESEARCH USE ONLY · NOT FOR HUMAN OR VETERINARY USE · 21+
