Metabolic Research

Cagrilintide - 5mg

CAS # 1415456-99-3

Cagrilintide is studied within peptide science for its structural
characteristics and relevance in receptor signaling and metabolic
research. Researchers may explore this compound in studies involving peptide interactions, regulatory pathways, and comparative laboratory analyses conducted in controlled environments.

★★★★★ 4.9 · verified researchers
Size / Format
Quantity
$59.95$38.96
Secure checkout American Express Diners ClubDiscoverJCBMaestroMastercard Visa
Purity≥99% HPLC
FormResearch material
CAS1415456-99-3
TestingISO 17025 3rd-party
Same-day dispatchorder before 4:30pm ET
Free reshipmentguaranteed delivery
ISO 17025 testedthird-party verified
Ships from the USAdiscreet & tracked

About Cagrilintide - 5mg

Cagrilintide (development code AM833) is a synthetic, long-acting amylin analog built on a 37-amino-acid pramlintide-like backbone with key substitutions and N-terminal fatty-diacid acylation via a gamma-glutamic acid linker. It contains an intramolecular disulfide bridge (Cys2-Cys7) and a C-terminal amide. In experimental systems it acts as a non-selective agonist of the amylin receptor family (AMY1-3) and the calcitonin receptor, with reported subpicomolar to picomolar binding affinities.

In preclinical and in-vitro research, cagrilintide has been studied for its prolonged receptor engagement relative to native amylin, and as a co-administration partner with GLP-1 receptor agonists in models of energy balance and food intake. Its acylation-based design confers extended circulating half-life, making it a reference amylin-class research peptide. This material is supplied strictly for Research Use Only.

Research use only — not for human or animal consumption. Per-batch documentation is provided with the material.

Handling and Storage Tips:

Keep peptides cold and away from light once received.

For short-term use (days to weeks), refrigeration at 4°C (39°F) is acceptable.

Lyophilized peptides are typically stable at room temperature for several weeks, making it suitable for moderate-term storage.

For long-term storage (months to years), it’s best to freeze peptides at -80°C (-112°F). Freezing optimally preserves peptide stability for extended periods.

FDA Disclosure & Intended Use:

FDA Disclosure: The statements on this website and the products sold herein have not been evaluated by the U.S. Food and Drug Administration (FDA). These products are not intended to diagnose, treat, cure, or prevent any disease. Products sold are for Research Use Only and are not for human or animal use.

Intended Purpose: Products sold on this site are intended solely for basic laboratory research, pharmaceutical research, or the development of new tests. They are not intended for diagnostic, therapeutic, or clinical use.

Specifications

Identification
  • MaterialCagrilintide - 5mg
  • Also searched asAM833
  • Research AreaMetabolic Research
  • Presentation
  • CAS Number1415456-99-3
  • Molecular FormulaC194H312N54O59S2
  • Molecular Weight4409.1 g/mol
  • TypeSynthetic acylated cyclic peptide (amylin analog)
  • Receptor / TargetAmylin receptors (AMY) and calcitonin receptor (CTR)
  • PubChem CID164618153 →
Amino Acid Sequence

(Eicosanedioic acid-γ-Glu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Cys2-Cys7 disulfide)

Analytical Data
  • Purity (HPLC)≥99%
  • Identity (MS)Confirmed to specification
  • TestingAccredited (ISO 17025) third-party laboratory
  • DocumentationPer-batch COA →
Key Characteristics
Molecular FormulaC194H312N54O59S2
Molecular Weight4409.1 g/mol
CAS Number1415456-99-3
PubChem CID164618153
Receptor / TargetAmylin receptors (AMY1-3) and calcitonin receptor (CTR)
Molecular TypeSynthetic 37-residue acylated cyclic peptide
FormLyophilized powder in vial
SolubilitySoluble in water and bacteriostatic water; aliquot after reconstitution
StorageStore lyophilized at -20 C to -80 C; protect from light
StabilityLyophilized stable for extended periods frozen; reconstituted solutions less stable, use promptly
Research Context
Amylin receptor pharmacologyReference agonist for AMY1-3 and calcitonin receptor binding and signaling studies.
Energy balance and satiety researchModel peptide used in preclinical study of food intake and body-weight regulation.
GLP-1 co-agonism studiesFrequently paired with GLP-1R agonists in combination metabolic-research models.
Long-acting peptide designIllustrates fatty-diacid acylation strategy for extended half-life amylin analogs.
Research Findings

Preclinical and early clinical-pharmacology research characterizes cagrilintide as a long-acting amylin analog with potent activity at amylin and calcitonin receptors and a markedly extended duration of action compared with native amylin. Studies have examined its effects on food intake and body weight in animal models and its combination with GLP-1 receptor agonists.

These observations derive from experimental and preclinical settings and are provided for scientific context only. No human efficacy, dosing, or therapeutic conclusions are implied by this listing.

History

Cagrilintide (AM833) was developed by Novo Nordisk as a long-acting amylin analog, extending the amylin-pharmacology field established by the earlier analog pramlintide. Its discovery and early pharmacology were reported by Kruse and colleagues, and it has since been studied both alone and in fixed combination with the GLP-1 agonist semaglutide (CagriSema).

References
  1. Kruse T, et al. (2021). Development of Cagrilintide, a Long-Acting Amylin Analogue. Journal of Medicinal Chemistry.
  2. Lau DCW, et al. (2021). Once-weekly cagrilintide for weight management in people with overweight and obesity: a multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase 2 trial. The Lancet.
  3. Enebo LB, et al. (2021). Safety, tolerability, pharmacokinetics, and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2.4 mg for weight management: a randomised, controlled, phase 1b trial. The Lancet.

View compound profile on NIH PubChem →

Cited literature refers to laboratory and preclinical research. This material is supplied strictly for research use only and is not intended to diagnose, treat, cure, or prevent any disease.

Why researchers choose Helio Peptides
99%+ PurityHPLC-verified every batch
Accredited TestingIndependent ISO 17025 laboratory
Per-Batch COADocumentation tied to your lot
Made in the USADiscreet, protected shipping
Frequently Asked
Are these research materials third-party tested?

Yes — every batch is analysed by an accredited (ISO 17025) independent laboratory using HPLC and mass spectrometry, with a per-batch Certificate of Analysis.

What purity are the materials?

Materials are verified to 99%+ HPLC purity. Any batch that does not meet the threshold is not released.

Do you provide a Certificate of Analysis (COA)?

Yes. Per-batch COA documentation is provided and is traceable by lot number.

Where do you ship from?

Materials are shipped from the USA in discreet, protective packaging.

Are these products for human use?

No. All materials are sold strictly for laboratory research use only — not for human or animal consumption, diagnosis, treatment, or prevention of any disease.

RESEARCH USE ONLY · NOT FOR HUMAN OR VETERINARY USE · 21+