Glp – 2 – 10MG
About Glp – 2 – 10MG
GLP-2 (1-33) is the native human form of glucagon-like peptide-2, a 33-amino-acid intestinotrophic peptide derived, like GLP-1, from post-translational processing of proglucagon in intestinal L-cells. In experimental systems it acts as an endogenous agonist of the glucagon-like peptide-2 receptor (GLP-2R), a class B G-protein-coupled receptor expressed predominantly in the gastrointestinal tract. Because "GLP-2" is a generic class designation, laboratory reference material typically corresponds to the native human GLP-2 (1-33) sequence.
In preclinical and in-vitro research, GLP-2 (1-33) has been studied as a regulator of intestinal epithelial biology, including models of crypt-cell proliferation, mucosal growth, and barrier function. Native GLP-2 is a substrate for dipeptidyl peptidase-4 (DPP-4), which cleaves its N-terminus and limits its duration of activity, a property central to studies underpinning DPP-4-resistant analogs such as teduglutide. This material is supplied strictly for Research Use Only.
Research use only — not for human or animal consumption. Per-batch documentation is provided with the material.
Handling and Storage Tips:
Keep peptides cold and away from light once received.
For short-term use (days to weeks), refrigeration at 4°C (39°F) is acceptable.
Lyophilized peptides are typically stable at room temperature for several weeks, making it suitable for moderate-term storage.
For long-term storage (months to years), it’s best to freeze peptides at -80°C (-112°F). Freezing optimally preserves peptide stability for extended periods.
FDA Disclosure & Intended Use:
FDA Disclosure: The statements on this website and the products sold herein have not been evaluated by the U.S. Food and Drug Administration (FDA). These products are not intended to diagnose, treat, cure, or prevent any disease. Products sold are for Research Use Only and are not for human or animal use.
Intended Purpose: Products sold on this site are intended solely for basic laboratory research, pharmaceutical research, or the development of new tests. They are not intended for diagnostic, therapeutic, or clinical use.
Specifications
- MaterialGlp – 2 – 10MG
- Also searched asGLP2, GLP 2
- Research AreaMetabolic Research
- Presentation—
- CAS Number223460-79-5
- Molecular FormulaC165H254N44O55S
- Molecular Weight3766.1 g/mol
- TypeLinear peptide (proglucagon-derived)
- Receptor / TargetGlucagon-like peptide-2 receptor (GLP-2R)
HADGSFSDEMNTILDNLAARDFINWLIQTKITD
- Purity (HPLC)≥99%
- Identity (MS)Confirmed to specification
- TestingAccredited (ISO 17025) third-party laboratory
- DocumentationPer-batch COA →
In vitro and preclinical studies describe GLP-2 (1-33) as a selective agonist of the GLP-2 receptor that has been associated with intestinal epithelial proliferation and mucosal growth in animal and cell-based models. Research has also documented rapid N-terminal inactivation of native GLP-2 by DPP-4, which motivated the design of degradation-resistant analogs.
These observations derive from experimental and in-vitro settings and are provided for scientific context only. No human efficacy, dosing, or therapeutic conclusions are implied.
Glucagon-like peptide-2 was identified in the 1990s as a proglucagon-derived peptide with intestinotrophic activity, characterized notably by Drucker and colleagues, who demonstrated its role in promoting intestinal growth. This work led directly to the development of the DPP-4-resistant analog teduglutide for short bowel syndrome.
- Drucker DJ, Erlich P, Asa SL, Brubaker PL (1996). Induction of intestinal epithelial proliferation by glucagon-like peptide 2. Proceedings of the National Academy of Sciences.
- Munroe DG, et al. (1999). Prototypic G protein-coupled receptor for the intestinotrophic factor glucagon-like peptide 2. Proceedings of the National Academy of Sciences.
- Drucker DJ, Yusta B (2014). Physiology and pharmacology of the enteroendocrine hormone glucagon-like peptide-2. Annual Review of Physiology.
Cited literature refers to laboratory and preclinical research. This material is supplied strictly for research use only and is not intended to diagnose, treat, cure, or prevent any disease.
Are these research materials third-party tested?
Yes — every batch is analysed by an accredited (ISO 17025) independent laboratory using HPLC and mass spectrometry, with a per-batch Certificate of Analysis.
What purity are the materials?
Materials are verified to 99%+ HPLC purity. Any batch that does not meet the threshold is not released.
Do you provide a Certificate of Analysis (COA)?
Yes. Per-batch COA documentation is provided and is traceable by lot number.
Where do you ship from?
Materials are shipped from the USA in discreet, protective packaging.
Are these products for human use?
No. All materials are sold strictly for laboratory research use only — not for human or animal consumption, diagnosis, treatment, or prevention of any disease.
More Metabolic Research materials
✓ ≥99% View COA ›
MOTS-c 10MG Research Vial - Mitochondrial-Derived Peptide | Third-Party Tested
✓ ≥99% View COA ›
GLP-3 (Retatrutide) 15MG Research Vial - GLP-1/GIP/Glucagon Triple Receptor Agonist | Third-Party Tested
RESEARCH USE ONLY · NOT FOR HUMAN OR VETERINARY USE · 21+
