GLP-2 5MG Research Vial - Glucagon-Like Peptide-2 | GLP-2R Agonist | Third-Party Tested

GLP-2 Research That Actually Gets Used

GLP-2 (Glucagon-Like Peptide-2) is one of the most studied intestinal peptide hormones in gastrointestinal biology - a 33-amino acid proglucagon-derived peptide secreted by enteroendocrine L cells of the distal ileum and proximal colon, with well-characterised roles in intestinal mucosal growth, nutrient absorption, gut barrier function, and intestinal blood flow. Its pharmaceutical analogue, is FDA-approved for short bowel syndrome - one of the few GI peptides to progress from basic research through to regulatory approval. The Helio Peptides GLP-2 5MG vial provides research-grade native sequence GLP-2 for laboratory investigation of the GLP-2 receptor system, intestinal biology, and gut-brain axis research.

Helio Peptides operates differently.

Every vial of GLP-2 goes through independent third-party testing at an ISO 17025-accredited laboratory before it ships - identity confirmed by HPLC and LC-MS, molecular weight verified by mass spectrometry, and assay content confirmed at the labelled 5MG. The Certificate of Analysis is available on request for every batch. At $74.95 per vial - or $67.46 in a pack of ten - Helio Peptides provides one of the most rigorously documented sources of research-grade GLP-2 available from a US-based ISO-accredited supplier.

What Is GLP-2 (Glucagon-Like Peptide-2)?

GLP-2 (Glucagon-Like Peptide-2) is a 33-amino acid peptide hormone derived from post-translational processing of the proglucagon precursor protein by prohormone convertase 1/3 (PC1/3) in enteroendocrine L cells of the small intestine and colon. It is co-secreted with GLP-1 in response to nutrient intake - particularly long-chain fatty acids and carbohydrates - from L cells located predominantly in the distal ileum and proximal colon.

GLP-2 exerts its biological effects exclusively through the GLP-2 receptor (GLP-2R) - a class B G-protein coupled receptor that signals through Gs/cAMP pathways. The GLP-2R is expressed in enteroendocrine cells, enteric neurons, subepithelial myofibroblasts, and smooth muscle cells of the gastrointestinal tract, as well as in the hypothalamus and brainstem. Unlike GLP-1R, GLP-2R is not expressed on pancreatic beta cells - GLP-2 has no direct insulin secretagogue activity.

Native GLP-2 has a plasma half-life of approximately 7 minutes - it is rapidly inactivated by DPP-IV (dipeptidyl peptidase-4), which cleaves the Ala²–Glu³ bond at the N-terminus to produce the inactive metabolite GLP-2(3–33). This rapid degradation limits native GLP-2's utility in extended in vivo studies - a limitation addressed by a DPP-IV-resistant analogue, a DPP-IV-resistant analogue in which alanine at position 2 is substituted with glycine, extending the half-life to approximately 2 hours. The Helio Peptides GLP-2 vial contains the native 33-amino acid sequence - appropriate for studies where native receptor binding kinetics, DPP-IV degradation dynamics, and authentic ligand-receptor interaction are the research objectives.

GLP-2 is a distinct peptide from GLP-1 (which targets the GLP-1 receptor to stimulate insulin secretion and suppress appetite) and from GLP-3 (an informal term for triple receptor agonists - see our GLP-3 15MG Vial). All three are derived from the same proglucagon precursor through tissue-specific processing, but each activates a different receptor with an entirely distinct pharmacological profile. GLP-2 is the only member of this family with a primary role in intestinal mucosal biology rather than metabolic regulation.

How Does GLP-2 Work? GLP-2 Receptor Signalling Explained

GLP-2 activates the GLP-2 receptor (GLP-2R), a class B GPCR that signals primarily through Gs-mediated cAMP accumulation, triggering PKA activation and downstream CREB phosphorylation in target cells. Because GLP-2R is not expressed on intestinal crypt epithelial cells directly, GLP-2's intestinotropic effects are mediated through paracrine intermediaries - a network of indirect signalling molecules that relay GLP-2R activation in receptor-positive cells to proliferative responses in adjacent crypt cells.

Intestinal Mucosal Growth - The Primary Research Application

GLP-2 stimulates intestinal crypt cell proliferation and villus elongation through indirect mechanisms involving IGF-1, IGF-2, keratinocyte growth factor (KGF/FGF-7), and ErbB ligands released by receptor-positive subepithelial myofibroblasts and enteric neurons. In small intestinal tissue, IGF-1 and ErbB ligand signalling are the primary mediators of GLP-2-stimulated crypt cell proliferation; in colonic tissue, KGF and IGF-2 are more important. This indirect paracrine mechanism - where GLP-2R activation in stromal cells drives epithelial proliferation - is one of the best-characterised examples of growth factor relay signalling in gut biology. Research applications in this area include studies of intestinal adaptation after massive resection (short bowel syndrome models), examination of the GLP-2/IGF axis in mucosal repair, and characterisation of GLP-2R expression and signalling in specific intestinal cell populations using our IGF-1 LR3 1MG Vial as the downstream IGF-1R agonist reference.

Gut Barrier Function and Mucosal Integrity

GLP-2 strengthens the intestinal mucosal barrier by increasing the expression of tight junction proteins including claudin-3, occludin, and zonula occludens-1 in intestinal epithelial cells. It also reduces intestinal permeability to macromolecules and bacterial lipopolysaccharide (LPS) translocation in preclinical models of gut barrier dysfunction. These properties have driven research interest in GLP-2 in inflammatory bowel disease (IBD), sepsis-associated gut dysfunction, and chemotherapy-induced mucositis model systems.

Nutrient Absorption and Digestive Enzyme Activity

GLP-2 enhances the absorptive capacity of the small intestine by increasing the surface area available for nutrient uptake (through mucosal growth), upregulating brush border enzyme activity (sucrase-isomaltase, maltase-glucoamylase), and stimulating sodium-glucose cotransporter (SGLT1) expression. These effects make GLP-2 a compound of interest in research examining malabsorption syndromes, post-surgical nutrient absorption adaptation, and the regulation of intestinal nutrient transport gene expression.

Mesenteric Blood Flow and Intestinal Perfusion

GLP-2 increases mesenteric blood flow through a nitric oxide-dependent mechanism following nutrient ingestion. This vasodilatory effect is mediated through GLP-2R activation in enteric neurons and smooth muscle cells, leading to increased blood flow to the small intestinal mucosa during the postprandial period. The regulation of intestinal perfusion by GLP-2 is studied in models of gut ischaemia-reperfusion injury and postprandial haemodynamic responses.

Central Nervous System and Gut-Brain Axis Research

GLP-2R is expressed in the hypothalamus, brainstem, and vagal afferent neurons - establishing GLP-2 as a gut-brain axis signalling peptide. Research has examined GLP-2's central effects on bone metabolism (GLP-2 has documented effects on bone resorption through central pathways), hypothalamic neuropeptide expression, and the role of vagal afferent GLP-2R signalling in postprandial satiety responses. This CNS expression pattern distinguishes GLP-2R biology from the purely peripheral receptor distribution of many GI peptides and has opened research directions in neuroendocrine gut-brain communication.

Research Applications

GLP-2 is investigated across multiple gastrointestinal, endocrine, and translational research directions. All applications below are for controlled laboratory environments only. This product is for research use only and is not for human or animal consumption.

Short Bowel Syndrome and Intestinal Adaptation Research

The most established preclinical research application for GLP-2 is the study of intestinal adaptation following massive small bowel resection - the pathophysiological basis of short bowel syndrome (SBS). Published murine and rodent model studies have demonstrated that GLP-2 exposure following 70–75% small bowel resection significantly enhances remnant intestinal adaptation - increasing villus height, crypt depth, enterocyte proliferation rate, and absorptive surface area compared to vehicle-treated controls. This body of work directly translated to the development of a DPP-IV-resistant analogue, FDA-approved in 2012 for SBS in adults and 2019 for paediatric SBS. Native GLP-2 research compounds provide the reference ligand for mechanistic dissection of GLP-2R signalling in SBS adaptation models.

Inflammatory Bowel Disease and Mucosal Repair Research

GLP-2's mucosal barrier-enhancing and enterotrophic properties have driven research interest in inflammatory bowel disease model systems. Studies in DSS-induced colitis, TNBS-induced colitis, and genetic IL-10 knockout mouse models have examined GLP-2's capacity to reduce intestinal inflammation, restore barrier function, and promote mucosal healing. The mechanism involves reduction of LPS translocation, downregulation of pro-inflammatory cytokines (TNF-α, IL-1β, IL-6), and promotion of epithelial restitution through GLP-2R-mediated growth factor release. Researchers may combine GLP-2 with our KPV 10MG Vial - an anti-inflammatory α-MSH tripeptide with documented effects in IBD models - and our BPC-157 Vial for comprehensive intestinal repair and anti-inflammatory research programmes.

Gut Barrier Function and Intestinal Permeability Research

GLP-2's documented effects on tight junction protein expression make it a reference compound in intestinal permeability research. Published studies have demonstrated that GLP-2 exposure reduces intestinal permeability as measured by FITC-dextran (4 kDa) translocation assays, lactulose/mannitol urinary excretion ratios, and transepithelial electrical resistance (TEER) in Caco-2 cell monolayer models. These applications are relevant to research examining leaky gut, LPS-driven systemic inflammation, and the role of intestinal barrier dysfunction in metabolic disease.

Bone Metabolism Research

GLP-2 has documented anti-resorptive effects on bone metabolism through a mechanism involving central GLP-2R activation in the hypothalamus, which modulates sympathetic nervous system outflow to bone through β-adrenergic receptor signalling on osteoblasts and osteoclasts. Research has demonstrated that GLP-2 exposure reduces urinary N-telopeptide (NTX) - a bone resorption biomarker - in both animal models and human studies. The GLP-2/bone axis represents an important gut-bone communication pathway relevant to research examining postprandial bone remodelling, osteoporosis, and the skeletal consequences of GI surgery.

DPP-IV Biology and Incretin Degradation Research

Native GLP-2's rapid DPP-IV-mediated degradation makes it a valuable substrate for studying DPP-IV enzyme kinetics and for examining how DPP-IV inhibition affects GLP-2 bioactivity. Research designs comparing native GLP-2 with the DPP-IV-resistant analogue a DPP-IV-resistant analogue allow systematic characterisation of how half-life extension shapes receptor occupancy, downstream signalling duration, and physiological endpoint magnitude in intestinal research models. This is directly analogous to the long-acting analogue vs native GLP-1 comparison in metabolic research.

Proglucagon Processing and L Cell Biology Research

GLP-2 is co-secreted with GLP-1 from enteroendocrine L cells through the same proglucagon processing pathway, making it a key compound for studies examining L cell biology, proglucagon gene expression, and PC1/3-mediated post-translational processing. Research in this area examines nutrient stimuli for GLP-2 and GLP-1 co-secretion, the relative stoichiometry of GLP-2 and GLP-1 release under different nutritional conditions, and the regulatory mechanisms governing L cell differentiation and density in the intestinal epithelium.

Product Specifications

Purity Testing & Certificate of Analysis

Every batch of Helio Peptides GLP-2 is independently tested before release. Not sampled - every batch. Testing is conducted by an ISO 17025-accredited third-party laboratory:

• HPLC (High-Performance Liquid Chromatography): Separates and quantifies GLP-2 against certified reference standards - confirms identity, detects synthesis by-products and truncated sequences, verifies purity at ≥99%

• LC-MS (Liquid Chromatography-Mass Spectrometry): Confirms molecular mass at 3,354.0 g/mol - verifies the complete 33-amino acid sequence and rules out DPP-IV-cleaved GLP-2(3–33) or other degradation products

• Assay / Content Testing: Confirms the exact quantity per vial matches the labelled 5MG

COA available on request. Email info@heliopeptides.com with your order number. For full COA methodology, visit our Certificate of Analysis and Testing page.

Storage Guidelines

• On delivery: refrigerate or freeze immediately

• Short-term (days to weeks): refrigerate at 4°C, away from direct light, in original sealed vial

• Long-term (months to years): freeze at -80°C - optimal for extended peptide stability. GLP-2 is susceptible to Asn deamidation under prolonged storage at above-freezing temperatures

• Avoid repeated freeze-thaw cycles: aliquot into single-use volumes before freezing

• Deamidation risk: GLP-2 contains asparagine (Asn) residues susceptible to deamidation under alkaline conditions or elevated temperature. Store at or below -20°C and avoid pH above 8.0

Helio Peptides ships all vials with cold-chain packaging. Contact info@heliopeptides.com or call 1-855-435-4633 immediately if you have concerns about vial condition on arrival.

Pack Options

For research programmes requiring consistent batch-matched supply, the pack of ten at $67.46 per vial is the most cost-efficient format. For institutional or wholesale pricing, contact our wholesale team directly.

Shipping & Fulfilment

Frequently Asked Questions

What is GLP-2 used for in research?

GLP-2 is studied in controlled laboratory settings for intestinal mucosal growth and adaptation (short bowel syndrome models), gut barrier function and permeability research, inflammatory bowel disease models, nutrient absorption and brush border enzyme regulation, DPP-IV substrate kinetics and incretin degradation research, bone metabolism via the gut-bone axis, and proglucagon processing and L cell biology. Research use only - not for human or animal consumption.

What is the molecular weight of GLP-2?

3,354.0 g/mol. Molecular formula C₁₅₂H₂₅₁N₄₃O₄₆. CAS number 105458-85-3. 33-amino acid peptide, sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD, derived from proglucagon by PC1/3 processing in intestinal L cells.

How does GLP-2 stimulate intestinal mucosal growth?

GLP-2 activates GLP-2R on subepithelial myofibroblasts and enteric neurons, which respond by releasing paracrine growth factors including IGF-1, IGF-2 (colonic), and KGF (FGF-7). These growth factors then act on adjacent crypt epithelial cells - which do not express GLP-2R directly - to stimulate proliferation and reduce apoptosis. The net result is increased crypt cell production rate, longer villi, greater mucosal surface area, and enhanced absorptive capacity.

What is the GLP-2 receptor and where is it expressed?

The GLP-2 receptor (GLP-2R) is a class B G-protein coupled receptor (Gs/cAMP signalling). In the gastrointestinal tract it is expressed in enteroendocrine cells, enteric neurons, and subepithelial myofibroblasts - notably NOT in intestinal crypt epithelial cells, which is why GLP-2's proliferative effects are indirect (mediated through paracrine growth factor release). GLP-2R is also expressed in the hypothalamus and brainstem, establishing the gut-brain axis role of GLP-2 in bone metabolism and satiety signalling.

Is every batch of GLP-2 third-party tested?

Yes - every batch. ISO 17025-accredited laboratory testing using HPLC and LC-MS confirms identity, purity (≥99%), and assay content at 5MG. Visit our Certificate of Analysis page or email info@heliopeptides.com to request your batch COA.

Where is Helio Peptides GLP-2 manufactured?

Synthesised in the United States in a controlled US-based facility. USA made, USA tested, shipped same day with cold-chain packaging.

Does Helio Peptides ship internationally?

Contact info@heliopeptides.com or call 1-855-435-4633 for current international shipping availability. Domestic US orders: same-day dispatch, 1–3 business day delivery.

What payment methods are accepted?

Credit/debit card (3D Secure), bank transfer, Ethereum (ETH), Bitcoin (BTC), and USDC at locked exchange rates.

Is there a bulk discount on GLP-2?

Yes. Pack of 10 at $67.46 per vial - 10% saving over $74.95 single price, $674.60 total for 50MG. For institutional or wholesale quantities, contact our wholesale team.

Explore More From Helio Peptides

• BPC-157 Vial - GI tract, gastric mucosal repair, and systemic tissue repair research

• KPV 10MG Vial - anti-inflammatory α-MSH tripeptide, IBD and gut immune research

• IGF-1 LR3 1MG Vial - downstream IGF-1R agonist, GLP-2-mediated intestinotrophic growth factor axis research

• GLP-3 15MG Vial - GLP-1R/GIPR/GCGR triple agonist, metabolic research

• Thymosin Alpha 1 5MG Vial - immune modulation, gut-immune axis research

• Glutathione 1500MG Vial - intestinal redox biology, gut barrier oxidative stress research

• TB-500 5MG Vial - tissue repair and regeneration research

• Certificate of Analysis & Testing - ISO 17025 testing methodology explained

• Wholesale & Bulk Orders - institutional pricing for research programmes

All products sold on heliopeptides.com are intended solely for laboratory research and are not for human or animal consumption. These statements have not been evaluated by the Food and Drug exposure. These products are not intended to diagnose, treat, cure, or prevent any disease. The Helio Peptides GLP-2 vial is a synthetic research peptide and is not a DPP-IV-resistant analogue, which is an FDA-approved pharmaceutical product. By purchasing, the buyer confirms they are a qualified researcher and agrees to comply with all applicable federal and state laws. Not for sale to persons under the age of 21.